Индекс


Ссылка на сообщениеhttp://forum-zavtra.org/msg.php?id=9371
Дата сообщенияЧетверг, 11 Февраль 2021 14:21
АвторBirdyaiv
В ответ наПонимаю, что тема оскомину набила, но новость в теме - важная.. радикально! (Унутре про вирус)
типа нарыли кодумент с флаерами разметки и что
самое время, естесснно, донесть про естественность материала, хотя бы и по аналогии с материей..

А вот что природа хотела сообчить об особых полипептидах вируса прямо скажем немандаринным слогом: "МАЙКИ ИЛ, ФЛА(ИНГ) ЛИТЛ АТ СЕЛ(Л)" или "МАЙ ЭЛС ЛИД" это пожалуй наиболее сапиенсно-хабилесное во всей этой стори
..
gene 27394..27759
/gene="ORF7a"
/locus_tag="GU280_gp07"
/db_xref="GeneID:43740573"
CDS 27394..27759
/gene="ORF7a"
/locus_tag="GU280_gp07"
/codon_start=1
/product="ORF7a protein"
/protein_id="YP_009724395.1"
/db_xref="GeneID:43740573"
/translation="MKIILFLALITLATCELYHYQECVRGTTVLLKEPCSSGTYEGNS
PFHPLADNKFALTCFSTQFAFACPDGVKHVYQLRARSVSPKLFIRQEEVQELYSPIFL
IVAAIVFITLCFTLKRKTE"
gene 27756..27887
/gene="ORF7b"
/locus_tag="GU280_gp08"
/db_xref="GeneID:43740574"
CDS 27756..27887
/gene="ORF7b"
/locus_tag="GU280_gp08"
/codon_start=1
/product="ORF7b"
/protein_id="YP_009725318.1"
/db_xref="GeneID:43740574"
/translation="MIELSLIDFYLCFLAFLLFLVLIMLIIFWFSLELQDHNETCHA"